General Information

  • ID:  hor001121
  • Uniprot ID:  A0A1S3KPX8??191-194)
  • Protein name:  FMRFamide
  • Gene name:  LOC106561380
  • Organism:  Salmo salar (Atlantic salmon)
  • Family:  Nucleobase:cation symporter-2 (NCS2) (TC 2.A.40) family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Salmo (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0022857 transmembrane transporter activity
  • GO BP:  GO:0055085 transmembrane transport; GO:0071702 organic substance transport
  • GO CC:  GO:0005886 plasma membrane; GO:0016020 membrane

Sequence Information

  • Sequence:  FMRF
  • Length:  4(191-194)
  • Propeptide:  MAPEKESNGLENYAFAIDGRFCDLEKDGEGSDLSEEDDKNKLAYCVTDIPPWYLCIILGIQHCLTAFGGIIAIPLILSQGLCLQHDSLTQGHLISTIFFVSGVCTLLQVTFGIRLPILQGGTFTLLAPSMAMLSMPEWTCPAWTQNASLVNTTSPEYVEVWQSRMRALQGSIMVGSLFQVLVGFSGLIGLFMRFIGPLTIAPTISLIGLSLYDSAGMNAGNHWGISTMTTALIILFSQYLRHIPVPFPTYSKTKK
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A1S3KPX8-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001121_AF2.pdbhor001121_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 65343 Formula: C29H41N7O5S
Absent amino acids: ACDEGHIKLNPQSTVWY Common amino acids: F
pI: 10.55 Basic residues: 1
Polar residues: 0 Hydrophobic residues: 2
Hydrophobicity: 75 Boman Index: -661
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 0
Instability Index: -1135 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  1486597
  • Title:  Colocalization of Neuropeptide Y (NPY)-like and FMRFamide-like Immunoreactivities in the Brain of the Atlantic Salmon (Salmo Salar)